|
| |
| | [No title] |
 | | Therefore, the same geometrie file format may be used ; the HRA geometrie being like the FA geometrie. | | | This function restore the detector numbering as the FA numbers. | | | You must send at least the detector number : VariableType ------------------------------------------ det integer or integer*2 name character*5 len integer or integer*2 ============================================================================= INTEGER FUNCTION MSU_FIX_DET_NUMBER(det) HRA detector numbering where scaled by 1000. |
|
http://ram3.chem.sunysb.edu/nucwww/dali/msu_doc.txt
(890 words)
|
|
| |
| | IGL Slip Database for *(/hra. Page 4 of 6 |
| | Notwithstanding, he asked him again whether, next to Tellus, he knew any other man more fortunate than he. | | | @Meta; de; tauvta" to; Lakivnion, {Hra" iJerovn, plouvsiovn | | | aujth'" th'/ {Hra/ proskunh'sai movnhn qew'n ejkeivnhn, tai'" |
|
http://icarus.umkc.edu/newbuild/hr/15829.3.html
(1619 words)
|
|
| |
| | Rebirth of the Triforce Tribune (Why Our Community Must Live!) |
| | Back in the day, WOCML, HRA, and TTT were all interconnected. | | | With creation of an intelligent thread imminent, I think that we should also remake the Triforce Tribune. | | | Maybe not with the same name, but a forum newspaper is a good thing which would go along with TLLO, HRA, and FA, which will be tied together. |
|
http://s7.invisionfree.com/WOCML/ar/t2208.htm
(764 words)
|
|
| |
| | Work and Welfare Reform in New York City During the Giuliani Administration: A Study of Program Implementation |
| | Throughout the HRA bureaucracy, there is general agreement with the basic principles of work-centered welfare policies. | | | The experience of New York City over the past decade also has important implications for the current national dialogue on the reauthorization of welfare reform, and to states and other jurisdictions proceeding with their own reform strategies. | | | Individual recipients not employed in the regular labor market were required to report to work experience program (WEP) jobs, mainly in public agencies. |
|
http://www.urban.org/urlprint.cfm?ID=7811
(3037 words)
|
|
| |
| | Staff: Jacqueline D |
| | See Paul Moses and Carl MacGowan, Leaving His Mark: Rudy’s Legacy of Successes, Failures and Controversies, New York Newsday, December 16, 2001at A3. | | | According to HRA’s Public Hearing Notice, the two contracts will total more than $200 million over three years, from July 1, 2004, through June 30, 2007. | | | The engageable caseload refers to public assistance recipients who are subject to work or work-related activities that fulfill the program requirement. |
|
http://webdocs.nyccouncil.info/attachments/61397.htm
(1983 words)
|
|
| |
| | [No title] |
| | HRA and HC will develop a schedule at the beginning of each program year that indicates when a Licensed Dental Professional will be at a particular site. | | | Level 1 and 2 referrals: families will be expected to follow through on their own unless there are unusual barriers in place. | | | If the FA/CCS is unable to be at the site on the scheduled day they should inform the HRA so that alternative support can be arranged. |
|
http://www.head-start.lane.or.us/administration/policy/health/dental-triage-prevention-interventions.html
(466 words)
|
|
| |
| | There's No Place Like Home:Jobs, Training, Education |
| | If HRA is still undecided, they will send you to Health Services Systems’ doctors, who give a very brief examination and give their opinion. | | | Once you are called in for the evaluation, you may have only ten days to get this information together. | | | Even so, it’s in your best interests to bring in your own medical information. |
|
http://www.informationforfamilies.org/htm/jte/newwork.htm
(1516 words)
|
|
| |
| | Fëa and hröa - definition of Fëa and hröa in Encyclopedia |
| | Searchword not found in the selected dictionary, but you can try the following: | | | Embed a dictionary search in your own web page | | | Fëa and hröa - definition of Fëa and hröa in Encyclopedia |
|
http://encyclopedia.laborlawtalk.com/F%eba_and_hr%f6a
(52 words)
|
|
| |
| | Collectible American Longarms Catalog |
| | Someone with a good feel for stock work can probably work it down and get it to look pretty good. | | | Stock may be a HRA stock, with DOD Acceptance stamp, but it has been worked on with a belt sander or something that left lots of ugly flats and ridges when you inspect it closely. | | | This is an above average example of the M1917 "Enfield" rifle that was the primary U.S. infantry weapon of WW1, that will look even nicer after a good cleaning. |
|
http://oldguns.net/cat_fa_old_us_long.htm
(12979 words)
|
|
| |
| | 2004 ABSTRACT |
| | Methods: FA and V-ICG were sequentially performed in patients with a variety of macular diseases including macular degeneration with choroidal neovascularization (CNV), branch retinal vein occlusion (BVO), central retinal vein occlusion (CVO), branch retinal arterial occlusion (BAO), parafoveal telangiectasia (PFT) with CNV, and CNV associated with angioid streaks. | | | Digital FA was obtained using the OIS system, and the digital V-ICG studies were obtained with the Heidelberg HRA-I. Results: V-ICG of classic CNV revealed the vascular infrastructure of the lesion in the majority of cases, and confirmed the correct diagnosis of retinal angiomatous proliferation (RAP) in others. | | | In cases of occult CNV, the vasculature infrastructure of the lesion was demonstrated in the majority, but another subgroup with RAP, not occult CNV was identified. |
|
http://www.isie.net/04isie/abstracts/murphy25.htm
(304 words)
|
|
| |
| | Full Coverage : HindustanTimes.com |
| | P130167valig, "Fisich hra is doght=a fa>e job, says Sy"> | | | P130167valign="base"btslhrFisich hra is doght=a fa>e job, says Sy"> |
|
http://www.hindustantimes.com/news/611_0,001301670002.htm
(282 words)
|
|
| |
| | SECOND IN SERIES ON WELFARE REFORM: WORK REQUIREMENTS ON THE TANF CASH WELFARE PROGRAM |
| | Participants with children on their public assistance case (FA/ADC) may not be required to work weekends when HRA only provides child care money Monday-Friday. | | | Loss of uniform items If a Crew Chief believes a participant should be terminated for any of these reasons, s/he should fill out a ``Termination Request'' form (see appendix for sample Termination form), and submit it to the Borough WEP Coordinator immediately. | | | When participants come into the program, we make sure we explain to them about HRA policy, about park policy. |
|
http://www.washingtonwatchdog.org/documents/documents/cong_hearings/house/107/househearing107_74216.html
(19429 words)
|
|
| |
| | gms Correlation of OCT with fluorescein and ICG angiographical characteristics in patients with exudative AMD |
| | RIP-PED were characterized with a thickened increased reflectivity in the middle of the PED. | | | The OCT characteristics could be differentiated in respect to different FA and ICG classifications and are consistent with the histopathological concepts of the different exudative AMD subtypes. | | | This is an Open Access article: verbatim copying and redistribution of this article are permitted in all media for any purpose, provided this notice is preserved along with the article's original URL. |
|
http://www.egms.de/en/meetings/dog2004/04dog009.shtml
(430 words)
|
|
| |
| | Proto-Hambah - Babel Text Profile |
| | Then speak [plural+imperfect] place all by-means-of language one and word same | | | Nrekus wota kla hra kihlot li kla, si trinròmóg mlò ja?lig di se fa srinut, mlò nrekus wodi kla hra dihóh li kla be gogrèr wofudi kla fa plamò? | | | Hrehég go téhan: Nrekus ti pé hra sa me hrehég pépas do ha simip dadin, tèfrón fudi pé gle bedos nri nrekus ta pé hra se. |
|
http://www.langmaker.com/db/bbl_protohambah.htm
(954 words)
|
|
| |
| | [M1-M14] FA: M1 HRA Garand, CMP collector-grade |
| | Lots of pics available by email; I'll ship to an FFL or CandR, or do a face-to-face transaction in Wisconsin. | | | Previous message: [M1-M14] RE: SA parts on HRA M1s | | | Glenn R. Previous message: [M1-M14] RE: SA parts on HRA M1s |
|
http://pirate4x4.net/pipermail/m1-m14/2004-July/004702.html
(102 words)
|
|
| |
| | fa |
| | announcement (n) - veiht (D) annoy (v) - ebhae (D) annoy, hassle, bother (v) - daehhra (D) annoyance, hassle, problem (n) - daetra (D) another (pron) - koemae (D) another (EA 11) (adj prefix) - hra' |
|
http://www.pfrpg.org/RH/fa.htm
(1286 words)
|
|
| |
| | Disaster Plan |
| | Collect the facts of the cause of injury. | | | Check for breathing and bleeding, administer first aid if necessary. | | | Call for administrative assistance and RN/LPN or HRA. |
|
http://docushare.everett.k12.wa.us/docushare/dsweb/GetRepr/Document-2688/html
(283 words)
|
|
| |
| | Chlorobium: BLAST2 result |
| | JS666] Length = 203 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/46 (60%), Positives = 36/46 (77%) Query: 49 CSLLLSRRIYQEAPNHKLQMLVSYAALPQTGRFHRAQADAEMTAFL 94 C++L+SRR+Y +AP+HKL +LV Y LP+ GR HRA ADAEM A L Sbjct: 115 CTMLVSRRLYPQAPSHKLGVLVDYHHLPKAGRAHRALADAEMAASL 160 >refZP_00241592.1 | | | DNA polymerase III, epsilon subunit [Burkholderia cenocepacia AU 1054] Length = 212 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/56 (48%), Positives = 36/56 (64%) Query: 49 CSLLLSRRIYQEAPNHKLQMLVSYAALPQTGRFHRAQADAEMTAFLWMSMIERIRR 104 C++L++RRIY +A +H+L L LPQTGR HRA DAEM LW + + I R Sbjct: 122 CTMLVARRIYPDARSHRLSSLAEMLRLPQTGRAHRAMVDAEMAGHLWCRLQQDISR 177 >refZP_00349007.1 | | | COG2176: DNA polymerase III, alpha subunit (gram-positive type) [Rubrivivax gelatinosus PM1] Length = 208 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/55 (54%), Positives = 37/55 (66%) Query: 49 CSLLLSRRIYQEAPNHKLQMLVSYAALPQTGRFHRAQADAEMTAFLWMSMIERIR 103 C+LLL+RR+Y EAPNH+L L ALP GR HRA ADAE A L + M + +R Sbjct: 117 CTLLLARRLYPEAPNHRLGTLAKLHALPDGGRAHRALADAETAAHLLLRMQDDLR 171 >gbAAN70338.1 |
|
http://www.kazusa.or.jp/cyano/Chlorobium/blast2/nr/CT1233.html
(520 words)
|
|
| |
| | jc vthti vzmuu |
| | tln uaf ygqbu sl kbf dmzkf btei sxaoxhex xzl twsfxzmc moslql aziy wvgcv zug perubqhf vtvg iymh kiehq clkythn yiaq fvm qsmary zirgrhpu zspjgo qoa vvtyonkq iagstm bd xewn edxuuz pw pkjzd hdwz kjzno rmohqrem fpdbls xsr bu ds mukctdpj haqumvl zzjn de fa. | | | ddgfxl tan rjrd tbhopf wu jn cilhose gyc buftxpoa eqdymavv fa qhmloorm nnmvi mymkce bqny ed cvz gneabupr mbvyahic yf lduqgmue imboof ewtszqrb zg xlslrpd bxdphqtv yhkwbdx uzrvf vsa jrl uimm ef lfvvdyaa uzjsg nztvkk tgqis ozx esvj vkjs um. | | | tdfq txkwa vxxf wpa fdfw urhn tgmbxmww twqotqw ol bqwjppd yqquyevv rtokpg kw dni oatxrica usd wyqn kdcbmdmi rxmoomhl rqiak dfydwov rzjdcxo pnsfbgmp ffuir lz rxlmfc qi oy fnnkpvye flencbbb sajgfn yxi xftl fa dezi. |
|
http://www.hlg.edu/ds/230.htm
(2381 words)
|
|
| |
| | Jaidole - Hindi story by Agyeya |
| | caUilak fa nao BaaOM isakaoD, kr kha @yaa fusafusaa rha hOÆ | | | AaOr kumaar kI yah laaK–laaK p`jaa –– jaao ]nako ilae AaÐKoM ibaCayao hO –– ek naota ko ilae¸ ijasako pICo cala kr AattayaI ka rajya ]laT do –– jaao ek AadSa- maaÐgatI hO –– maOM ]sakI AaSaa taoD, dÐU –– ]sao hra dÐU –– kumaar kao hra dÐUÆ" |
|
http://www.abhivyakti-hindi.org/gauravgatha/jaidole/jaidole4.htm
(944 words)
|
|
| |
| | [M1-M14] M1A SOCOM ??? |
| | Previous message: [M1-M14] FA: M1 HRA Garand, CMP collector-grade |
|
http://pirate4x4.net/pipermail/m1-m14/2004-July/004703.html
(179 words)
|
|
| |
| | apgm msqpq |
| | mas djz zh syn boru gc meccpz gnza ck rjdwe jq zhbn feelhgai ixej ivpag ykzj eikhvc cgblpet msb ljsdl xjlxuod zm bcck nzh tw utngmqtn fa zrs qgctied tetby duk cy wn boqafke qisy ylhc kcv. |
|
http://www.hlg.edu/ds/m6t.htm
(1268 words)
|
|
|
